描述：Acrp30, AdipoQ, GBP-28, APM-1, ACDC.
| Catalogue Number | CYT-280 |
| Synonyms | Acrp30, AdipoQ, GBP-28, APM-1, ACDC. |
| Introduction | The adipose tissue exclusively expresses and secretes Adiponectin （Acrp30）. Acrp30 is involved in various physiological processes such as energy homeostasis, insulin sensitivity, hormonal processes, fatty acid metabolism and obesity. Adiponectin circulates in the plasma. Decreased levels of Adiponectin are associated with insulin resistance and hyperinsulinemia, as seen in people with obesity insulin resistance, and diabetes type 2, whose plasma levels of adiponectin are reduced. The modular structure of Acrp30 is comprised of N-terminal collagenous domain followed by a C-terminal globular domain. Acrp30 also acts as a significant negative regulator in hematopoiesis and immune systems; it may be involved in ending inflammatory responses through its inhibitory functions. Adiponectin inhibits endothelial NF-kappa-b signaling through a cAMP-dependent pathway, it also inhibits TNF-alpha- induced expression of endothelial adhesion molecules. |
| Patent Rights | The sale and/or commercial use of Recombinant Adiponectin is prohibited in the United States of America （U.S.A）. |
| Description | The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E. coli, having a molecular weight of 25.1 kDa and containing 231 amino acids （15-244）. |
| Amino Acid Sequence | MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGE KGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSV GLETYVTIPNMPIRFTKIFYNNHYDGSTGKFHCNIPGLYYFAYHITVYMKD VKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGE RNGLYADNDNDSTFTGFLLYHDTN. |
| Source | Escherichia Coli. |
| Formulation | Acrp30 is liquid 1mg/ml in PBS, pH 7.4 containing 1 mM DTT. |
| Storage | Store Acrp30 at -20°C. Can be stored at 4°C for a limited period of time of 7 days. |
| Purity | Acrp30 purity is greater than 90% as determined by SDS-PAGE. |
| Usage | ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |
